PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g32720.1.p
Common NameLOC104582109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 388aa    MW: 41981.8 Da    PI: 9.7687
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g32720.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-152370148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+ Ed  l++ v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Bradi1g32720.1.p 23 KGPWTQAEDTVLLEHVRRHGEGNWNAVRREAGLQRCGKSCRLRWANHL 70
                      79******************************************9986 PP

2Myb_DNA-binding46.77.4e-1576119146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g+++++E+ l+++++ + G++ W++I+++++ gRt++++k++w++
  Bradi1g32720.1.p  76 KGPFSPDEERLILRLHGLIGNK-WARISSHLP-GRTDNEVKNYWNT 119
                       79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.3721870IPR017930Myb domain
SuperFamilySSF466892.81E-3020117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-212173IPR009057Homeodomain-like
SMARTSM007171.3E-122272IPR001005SANT/Myb domain
PfamPF002495.1E-142370IPR001005SANT/Myb domain
CDDcd001672.83E-102570No hitNo description
PROSITE patternPS0017503847IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.28371125IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2474124IPR009057Homeodomain-like
SMARTSM007172.2E-1575123IPR001005SANT/Myb domain
PfamPF002493.7E-1476119IPR001005SANT/Myb domain
CDDcd001671.93E-1078121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MSSRGNNGGG GGGGGGELGG LKKGPWTQAE DTVLLEHVRR HGEGNWNAVR REAGLQRCGK  60
SCRLRWANHL RPNLRKGPFS PDEERLILRL HGLIGNKWAR ISSHLPGRTD NEVKNYWNTR  120
LKRRQRAGQP MYPPDVEREI ALFRAHNLNP FAPAPAARAA RPAPLVLQDG RNSFALPPKV  180
PSPSSASASA HSPLINQSYP LLNQIQQQQH HHGNHHHAHH HPVLHHHGGG GFRAAAGLPP  240
LPARAREVLH PSNQFHAAAD DGGDGLSLGL LEAMLLGEEN LTHHHRQTSS QYSPAPGNQD  300
PLHGGKWDFL FDDMKAETGR TANAAVEEMP ASMFVGPVSR DQWLQGTGGG SPGPSSVVTT  360
DDEFGGLDVQ RLMSSLPLST GELNWNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28211245107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3738041e-128AK373804.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3044A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229745.10.0PREDICTED: uncharacterized protein LOC104582109
TrEMBLI1GW630.0I1GW63_BRADI; Uncharacterized protein
STRINGBRADI1G32720.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.13e-58myb domain protein 101